CD3D_HUMAN   P04234


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P04234

Recommended name:T-cell surface glycoprotein CD3 delta chain

EC number:

Alternative names:(T-cell receptor T3 delta chain) (CD antigen CD3d)

Cleaved into:

GeneID:915

Gene names  (primary ):CD3D

Gene names  (synonym ):T3D

Gene names  (ORF ):

Length:171

Mass:18930

Sequence:MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK

Tissue specificity:CD3D is mostly present on T-lymphocytes with its TCR-CD3 partners. Present also in fetal NK-cells. {ECO:0000269|PubMed:1372642}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp