TCAL7_HUMAN Q9BRU2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BRU2
Recommended name：Transcription elongation factor A protein-like 7
EC number：
Alternative names：(TCEA-like protein 7) (Transcription elongation factor S-II protein-like 7)
Cleaved into：
GeneID：56849
Gene names (primary )：TCEAL7
Gene names (synonym )：
Gene names (ORF )：
Length：100
Mass：12324
Sequence：MQKPCKENEGKPKCSVPKREEKRPYGEFERQQTEGNFRQRLLQSLEEFKEDIDYRHFKDEEMTREGDEMERCLEEIRGLRKKFRALHSNHRHSRDRPYPI
Tissue specificity：Highly expressed in normal and fetal brain tissues, and weakly expressed in uterus and ovary. Down-regulated in epithelial ovarian, cervical, prostate, breast, brain and lung cancer cell lines and in brain and ovarian tumors. {ECO:0000269|PubMed:18806825}.
Induction：
Developmental stage：
Protein families：TFS-II family, TFA subfamily