TBPL2_HUMAN Q6SJ96
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6SJ96
Recommended name：TATA box-binding protein-like 2
EC number：
Alternative names：(TBP-like 2) (TATA box-binding protein-related factor 3) (TBP-related factor 3)
Cleaved into：
GeneID：387332
Gene names (primary )：TBPL2
Gene names (synonym )：TBP2 TRF3
Gene names (ORF )：
Length：375
Mass：41524
Sequence：MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPLFSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHETEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSLASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCDVRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYEAFENIYPILKGFKKA
Tissue specificity：Ubiquitously expressed in all tissues examined with highest levels in heart, lung, ovary, spleen and testes. {ECO:0000269|PubMed:14634207, ECO:0000269|PubMed:17570761}.
Induction：
Developmental stage：
Protein families：TBP family