TAAR8_HUMAN Q969N4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969N4
Recommended name：Trace amine-associated receptor 8
EC number：
Alternative names：(TaR-8) (Trace amine receptor 8) (G-protein coupled receptor 102) (Trace amine receptor 5) (TaR-5)
Cleaved into：
GeneID：83551
Gene names (primary )：TAAR8
Gene names (synonym )：GPR102 TA5 TAR5 TRAR5
Gene names (ORF )：
Length：342
Mass：38029
Sequence：MTSNFSQPVVQLCYEDVNGSCIETPYSPGSRVILYTAFSFGSLLAVFGNLLVMTSVLHFKQLHSPTNFLIASLACADFLVGVTVMLFSMVRTVESCWYFGAKFCTLHSCCDVAFCYSSVLHLCFICIDRYIVVTDPLVYATKFTVSVSGICISVSWILPLTYSGAVFYTGVNDDGLEELVSALNCVGGCQIIVSQGWVLIDFLLFFIPTLVMIILYSKIFLIAKQQAIKIETTSSKVESSSESYKIRVAKRERKAAKTLGVTVLAFVISWLPYTVDILIDAFMGFLTPAYIYEICCWSAYYNSAMNPLIYALFYPWFRKAIKLILSGDVLKASSSTISLFLE
Tissue specificity：Expressed in kidney and amygdala. Not expressed in other tissues or brain regions tested. {ECO:0000269|PubMed:11459929}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family