SFTA2_HUMAN Q6UW10
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6UW10
Recommended name：Surfactant-associated protein 2
EC number：
Alternative names：(Surfactant-associated protein G) (SP-G)
Cleaved into：
GeneID：389376
Gene names (primary )：SFTA2
Gene names (synonym )：SFTPG
Gene names (ORF )：UNQ541/PRO1098
Length：78
Mass：8396
Sequence：MGSGLPLVLLLTLLGSSHGTGPGMTLQLKLKESFLTNSSYESSFLELLEKLCLLLHLPSGTSVTLHHARSQHHVVCNT
Tissue specificity：Predominantly expressed in lung, where it is detected in type II pneumocytes in the alveolus, and in nonciliated epithelium in bronchioli (at protein level). Also detected at lower levels in cervix, esophagus, stomach, testis and kidney. {ECO:0000269|PubMed:22768197}.
Induction：
Developmental stage：
Protein families：