ST134_HUMAN   Q8IZP2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8IZP2

Recommended name:Putative protein FAM10A4

EC number:

Alternative names:(Suppression of tumorigenicity 13 pseudogene 4)

Cleaved into:

GeneID:

Gene names  (primary ):ST13P4

Gene names  (synonym ):FAM10A4

Gene names  (ORF ):

Length:240

Mass:27407

Sequence:MDPRKVNELRAFVKMCKKDPSILHTQEMRFLREWVESMGGTATQKAKSEENTKEEKPDSKVEEDLKADEPSSEESDLEIDKEGVIEPDTDAPQEMGDENAEITEEVMDQANDKKVAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIRDCDRAIEINPDSAQPYKRRGKAHRLLGHWEEAAHDLALACKFDYDEDASAMLKEVQPRAQKIAEHQRKYERKREE

Tissue specificity:Highly expressed in bone marrow and weakly in placenta, pancreas, heart and HeLa cell line. {ECO:0000269|PubMed:12079276}.

Induction:

Developmental stage:

Protein families:FAM10 family


   💬 WhatsApp