SUMO4_HUMAN   Q6EEV6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6EEV6

Recommended name:Small ubiquitin-related modifier 4

EC number:

Alternative names:(SUMO-4) (Small ubiquitin-like protein 4)

Cleaved into:

GeneID:387082

Gene names  (primary ):SUMO4

Gene names  (synonym ):SMT3H4

Gene names  (ORF ):

Length:95

Mass:10685

Sequence:MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSMKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY

Tissue specificity:Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen. {ECO:0000269|PubMed:15123604, ECO:0000269|PubMed:15247916}.

Induction:

Developmental stage:

Protein families:Ubiquitin family, SUMO subfamily


   💬 WhatsApp