SUMO2_HUMAN   P61956


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61956

Recommended name:Small ubiquitin-related modifier 2

EC number:

Alternative names:(SUMO-2) (HSMT3) (SMT3 homolog 2) (SUMO-3) (Sentrin-2) (Ubiquitin-like protein SMT3B) (Smt3B)

Cleaved into:

GeneID:6613

Gene names  (primary ):SUMO2

Gene names  (synonym ):SMT3B SMT3H2

Gene names  (ORF ):

Length:95

Mass:10871

Sequence:MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Tissue specificity:Broadly expressed. {ECO:0000269|PubMed:9556629}.

Induction:

Developmental stage:

Protein families:Ubiquitin family, SUMO subfamily


   💬 WhatsApp