SUMO1_HUMAN   P63165


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63165

Recommended name:Small ubiquitin-related modifier 1

EC number:

Alternative names:(SUMO-1) (GAP-modifying protein 1) (GMP1) (SMT3 homolog 3) (Sentrin) (Ubiquitin-homology domain protein PIC1) (Ubiquitin-like protein SMT3C) (Smt3C) (Ubiquitin-like protein UBL1)

Cleaved into:

GeneID:7341

Gene names  (primary ):SUMO1

Gene names  (synonym ):SMT3C SMT3H3 UBL1

Gene names  (ORF ):OK/SW-cl.43

Length:101

Mass:11557

Sequence:MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV

Tissue specificity:

Induction:

Developmental stage:

Protein families:Ubiquitin family, SUMO subfamily


   💬 WhatsApp