STP1_HUMAN   P09430


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P09430

Recommended name:Spermatid nuclear transition protein 1

EC number:

Alternative names:(STP-1) (TP-1)

Cleaved into:

GeneID:7141

Gene names  (primary ):TNP1

Gene names  (synonym ):

Gene names  (ORF ):

Length:55

Mass:6424

Sequence:MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRNYRSHL

Tissue specificity:Expressed by spermatids (at protein level). {ECO:0000269|PubMed:9809674}.

Induction:

Developmental stage:

Protein families:Nuclear transition protein 1 family


   💬 WhatsApp