ZN589_HUMAN Q86UQ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86UQ0
Recommended name：Zinc finger protein 589
EC number：
Alternative names：(Stem cell zinc finger protein 1)
Cleaved into：
GeneID：51385
Gene names (primary )：ZNF589
Gene names (synonym )：SZF1
Gene names (ORF )：
Length：364
Mass：41189
Sequence：MWAPREQLLGWTAEALPAKDSAWPWEEKPRYLGPVTFEDVAVLFTEAEWKRLSLEQRNLYKEVMLENLRNLVSLAESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVCRECGRGFSRKSQLIIHQRTHTGEKPYVCGECGRGFIVESVLRNHLSTHSGEKPYVCSHCGRGFSCKPYLIRHQRTHTREKSFMCTVCGRGFREKSELIKHQRIHTGDKPYVCRD
Tissue specificity：Isoform 2 is widely expressed. Isoform 3 is only expressed in CD34(+) cells. {ECO:0000269|PubMed:10029171}.
Induction：
Developmental stage：
Protein families：Krueppel C2H2-type zinc-finger protein family