ST2A1_HUMAN Q06520
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06520
Recommended name：Sulfotransferase 2A1
EC number：EC:2.8.2.2
Alternative names：(ST2A1) (Bile salt sulfotransferase) (Dehydroepiandrosterone sulfotransferase) (DHEA-ST) (DHEA-ST8) (Hydroxysteroid Sulfotransferase) (HST) (ST2) (SULT2A3)
Cleaved into：
GeneID：6822
Gene names (primary )：SULT2A1
Gene names (synonym )：HST STD
Gene names (ORF )：
Length：285
Mass：33780
Sequence：MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Tissue specificity：Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
Induction：
Developmental stage：
Protein families：Sulfotransferase 1 family