ST1C2_HUMAN O00338
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O00338
Recommended name：Sulfotransferase 1C2
EC number：EC:2.8.2.-
Alternative names：(ST1C2) (Sulfotransferase 1C1) (SULT1C#1) (humSULTC2)
Cleaved into：
GeneID：6819
Gene names (primary )：SULT1C2
Gene names (synonym )：SULT1C1
Gene names (ORF )：
Length：296
Mass：34880
Sequence：MALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Tissue specificity：Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
Induction：
Developmental stage：
Protein families：Sulfotransferase 1 family