ST1A2_HUMAN P50226
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50226
Recommended name：Sulfotransferase 1A2
EC number：EC:2.8.2.1
Alternative names：(ST1A2) (Aryl sulfotransferase 2) (Phenol sulfotransferase 2) (Phenol-sulfating phenol sulfotransferase 2) (P-PST 2)
Cleaved into：
GeneID：6799
Gene names (primary )：SULT1A2
Gene names (synonym )：STP2
Gene names (ORF )：
Length：295
Mass：34310
Sequence：MELIQDISRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGTTWVSQILDMIYQGGDLEKCHRAPIFMRVPFLEFKVPGIPSGMETLKNTPAPRLLKTHLPLALLPQTLLDQKVKVVYVARNAKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETVDLMVEHTSFKEMKKNPMTNYTTVRREFMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAKKMAGCSLSFRSEL
Tissue specificity：
Induction：
Developmental stage：
Protein families：Sulfotransferase 1 family