SPRNG_HUMAN   Q9H741


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H741

Recommended name:SREBP regulating gene protein

EC number:

Alternative names:(SREBF pathway regulator in Golgi 1)

Cleaved into:

GeneID:79794

Gene names  (primary ):SPRING1

Gene names  (synonym ):C12orf49 SPRING

Gene names  (ORF ):

Length:205

Mass:23594

Sequence:MVNLAAMVWRRLLRKRWVLALVFGLSLVYFLSSTFKQEERAVRDRNLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSSQSVQHENTYRDPIAKYCYGESPPELFPA

Tissue specificity:

Induction:

Developmental stage:

Protein families:SPRING family


   💬 WhatsApp