SPTOS_HUMAN   A0A0U1RRN3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A0U1RRN3

Recommended name:Putative transmembrane protein SPTY2D1OS

EC number:

Alternative names:(SPTY2D1 antisense RNA 1) (SPTY2D1 opposite strand)

Cleaved into:

GeneID:

Gene names  (primary ):SPTY2D1OS

Gene names  (synonym ):SPTY2D1-AS1

Gene names  (ORF ):

Length:59

Mass:6977

Sequence:MIVLGWMFFVGLVCYMGTFPELMPPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp