SRSF7_HUMAN   Q16629


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q16629

Recommended name:Serine/arginine-rich splicing factor 7

EC number:

Alternative names:(Splicing factor 9G8) (Splicing factor, arginine/serine-rich 7)

Cleaved into:

GeneID:6432

Gene names  (primary ):SRSF7

Gene names  (synonym ):SFRS7

Gene names  (ORF ):

Length:238

Mass:27367

Sequence:MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD

Tissue specificity:Brain, liver, kidney and lung.

Induction:

Developmental stage:

Protein families:Splicing factor SR family


   💬 WhatsApp