SPAT8_HUMAN   Q6RVD6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6RVD6

Recommended name:Spermatogenesis-associated protein 8

EC number:

Alternative names:(Spermatogenesis-related protein 8)

Cleaved into:

GeneID:

Gene names  (primary ):SPATA8

Gene names  (synonym ):

Gene names  (ORF ):

Length:105

Mass:11727

Sequence:MAPAGMSGAQDNSCLYQEIAPSFQRLPCPRTSSRHFSEAMTCPCGWRPFKGGPGGLKGPVWPAKEENSCSHGRIQRVQRRRVPSASPLIQKINRRSVLFHPYCWS

Tissue specificity:Expressed at high levels in adult testis, at moderate levels in sperm and at low levels in fetal testis. Not detected in other tissues. {ECO:0000269|PubMed:16809841}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp