TXND8_HUMAN Q6A555
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6A555
Recommended name：Thioredoxin domain-containing protein 8
EC number：
Alternative names：(Spermatid-specific thioredoxin-3) (Sptrx-3) (Thioredoxin-6)
Cleaved into：
GeneID：255220
Gene names (primary )：TXNDC8
Gene names (synonym )：SPTRX3 TRX6
Gene names (ORF )：
Length：127
Mass：14575
Sequence：MVQIIKDTNEFKTFLTAAGHKLAVVQFSSKRCGPCKRMFPVFHAMSVKYQNVFFANVDVNNSPELAETCHIKTIPTFQMFKKSQKVTLFSRIKRIICCYRSGFMSNLIFEFCGADAKKLEAKTQELM
Tissue specificity：Testis-specific. Only expressed during spermiogenesis, prominently in the Golgi apparatus of pachytene spermatocytes and round and elongated spermatids, with a transient localization in the developing acrosome of round spermatids (at protein level). {ECO:0000269|PubMed:15181017}.
Induction：
Developmental stage：
Protein families：Thioredoxin family