SPGOS_HUMAN   P0CW21


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0CW21

Recommended name:Putative uncharacterized protein SPART-AS1

EC number:

Alternative names:(SPART antisense RNA 1) (SPG20 antisense RNA 1) (SPG20 opposite strand transcript protein)

Cleaved into:

GeneID:

Gene names  (primary ):SPART-AS1

Gene names  (synonym ):C13orf43 SPG20-AS1 SPG20OS

Gene names  (ORF ):

Length:52

Mass:6167

Sequence:MKDIGHLQHLAQRLQWNRRAVNICGMHGWTKDLSPHSRMPSMLEHVKHYMSC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp