SL9P1_HUMAN   A6NJY1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NJY1

Recommended name:Putative SLC9B1-like protein SLC9B1P1

EC number:

Alternative names:(Solute carrier family 9 subfamily B member 1 pseudogene 1)

Cleaved into:

GeneID:

Gene names  (primary ):SLC9B1P1

Gene names  (synonym ):

Gene names  (ORF ):

Length:282

Mass:30828

Sequence:MVLQENGYGVEEDIPTLLMAASSMDDLLAITGFNTCLSIVFYSGGMINNAIASLRNVCISLLAGIVLGFFVRYFPSEDQKKITLKRGFLVLITFVSAVLGSQPIGLHGSGGLCTLVLHFIEWTKWSQEKMKVQKIITNVWDIFQPLLFGLVGAEVSVSLLESNIVGISVSTLSLALCVRILNIYLLMCFAGFSFKEKIFIALAWMPKATVQAVLGPLALETARVSTPHLETYAKDVMTVAFLAIMITAPNGALLMGILGPKMLTRHYDPSKIKLQLSTLEHH

Tissue specificity:

Induction:

Developmental stage:

Protein families:Monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family


   💬 WhatsApp