ORNT2_HUMAN Q9BXI2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9BXI2
Recommended name：Mitochondrial ornithine transporter 2
EC number：
Alternative names：(Solute carrier family 25 member 2)
Cleaved into：
GeneID：83884
Gene names (primary )：SLC25A2
Gene names (synonym )：ORNT2
Gene names (ORF )：
Length：301
Mass：32580
Sequence：MKSGPGIQAAIDLTAGAAGGTACVLTGQPFDTIKVKMQTFPDLYKGLTDCFLKTYAQVGLRGFYKGTGPALMAYVAENSVLFMCYGFCQQFVRKVAGMDKQAKLSDLQTAAAGSFASAFAALALCPTELVKCRLQTMYEMEMSGKIAKSHNTIWSVVKGILKKDGPLGFYHGLSSTLLQEVPGYFFFFGGYELSRSFFASGRSKDELGPVHLMLSGGVAGICLWLVVFPVDCIKSRIQVLSMYGKQAGFIGTLLSVVRNEGIVALYSGLKATMIRAIPANGALFVAYEYSRKMMMKQLEAY
Tissue specificity：Expressed in liver, kidney, pancreas and cultured fibroblasts.
Induction：
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family