AT1B3_HUMAN P54709
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P54709
Recommended name：Sodium/potassium-transporting ATPase subunit beta-3
EC number：
Alternative names：(Sodium/potassium-dependent ATPase subunit beta-3) (ATPB-3) (CD antigen CD298)
Cleaved into：
GeneID：483
Gene names (primary )：ATP1B3
Gene names (synonym )：
Gene names (ORF )：
Length：279
Mass：31513
Sequence：MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Tissue specificity：
Induction：
Developmental stage：
Protein families：X(+)/potassium ATPases subunit beta family