AT1B1_HUMAN   P05026


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P05026

Recommended name:Sodium/potassium-transporting ATPase subunit beta-1

EC number:

Alternative names:(Sodium/potassium-dependent ATPase subunit beta-1)

Cleaved into:

GeneID:481

Gene names  (primary ):ATP1B1

Gene names  (synonym ):ATP1B

Gene names  (ORF ):

Length:303

Mass:35061

Sequence:MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

Tissue specificity:Found in most tissues.

Induction:

Developmental stage:

Protein families:X(+)/potassium ATPases subunit beta family


   💬 WhatsApp