SNPC5_HUMAN   O75971


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O75971

Recommended name:snRNA-activating protein complex subunit 5

EC number:

Alternative names:(SNAPc subunit 5) (Small nuclear RNA-activating complex polypeptide 5) (snRNA-activating protein complex 19 kDa subunit) (SNAPc 19 kDa subunit)

Cleaved into:

GeneID:10302

Gene names  (primary ):SNAPC5

Gene names  (synonym ):SNAP19

Gene names  (ORF ):

Length:98

Mass:11328

Sequence:MLSRLQELRKEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSHDMLVHVDNEASINQTTLELSTKSHVTEEEEEEEEEESDS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp