SMAGP_HUMAN   Q0VAQ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q0VAQ4

Recommended name:Small cell adhesion glycoprotein

EC number:

Alternative names:(Small transmembrane and glycosylated protein)

Cleaved into:

GeneID:57228

Gene names  (primary ):SMAGP

Gene names  (synonym ):

Gene names  (ORF ):

Length:97

Mass:10679

Sequence:MTSLLTTPSPREELMTTPILQPTEALSPEDGASTALIAVVITVVFLTLLSVVILIFFYLYKNKGSYVTYEPTEGEPSAIVQMESDLAKGSEKEEYFI

Tissue specificity:Detected in breast, endometrium, colon and biliary tract. Detected in polarized epithelial structures characterized by cell-cell adhesion (at protein level). {ECO:0000269|PubMed:15021913}.

Induction:

Developmental stage:

Protein families:SMAGP family


   💬 WhatsApp