RS4Y1_HUMAN P22090
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22090
Recommended name：40S ribosomal protein S4, Y isoform 1
EC number：
Alternative names：(Small ribosomal subunit protein eS4)
Cleaved into：
GeneID：6192
Gene names (primary )：RPS4Y1
Gene names (synonym )：RPS4Y
Gene names (ORF )：PRO2646
Length：263
Mass：29456
Sequence：MARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIVFLRNRLKYALTGDEVKKICMQRFIKIDGKVRVDVTYPAGFMDVISIEKTGEHFRLVYDTKGRFAVHRITVEEAKYKLCKVRKITVGVKGIPHLVTHDARTIRYPDPVIKVNDTVQIDLGTGKIINFIKFDTGNLCMVIGGANLGRVGVITNRERHPGSFDVVHVKDANGNSFATRLSNIFVIGNGNKPWISLPRGKGIRLTVAEERDKRLATKQSSG
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic ribosomal protein eS4 family