TM50A_HUMAN O95807
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95807
Recommended name：Transmembrane protein 50A
EC number：
Alternative names：(Small membrane protein 1)
Cleaved into：
GeneID：23585
Gene names (primary )：TMEM50A
Gene names (synonym )：SMP1
Gene names (ORF )：UNQ386/PRO718
Length：157
Mass：17400
Sequence：MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：UPF0220 family