STML1_HUMAN   Q9UBI4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UBI4

Recommended name:Stomatin-like protein 1

EC number:

Alternative names:(SLP-1) (EPB72-like protein 1) (Protein unc-24 homolog) (Stomatin-related protein) (STORP)

Cleaved into:

GeneID:9399

Gene names  (primary ):STOML1

Gene names  (synonym ):SLP1 UNC24

Gene names  (ORF ):MSTP019

Length:398

Mass:42968

Sequence:MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDVVVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK

Tissue specificity:Ubiquitously expressed at low levels. Expression is highest in brain. {ECO:0000269|PubMed:10997330, ECO:0000269|PubMed:9931417}.

Induction:

Developmental stage:

Protein families:Band 7/mec-2 family


   💬 WhatsApp