HSDL1_HUMAN Q3SXM5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3SXM5
Recommended name：Inactive hydroxysteroid dehydrogenase-like protein 1
EC number：
Alternative names：(Short chain dehydrogenase/reductase family 12C member 3)
Cleaved into：
GeneID：83693
Gene names (primary )：HSDL1
Gene names (synonym )：SDR12C3
Gene names (ORF )：
Length：330
Mass：37002
Sequence：MAAVDSFYLLYREIARSCNCYMEALALVGAWYTARKSITVICDFYSLIRLHFIPRLGSRADLIKQYGRWAVVSGATDGIGKAYAEELASRGLNIILISRNEEKLQVVAKDIADTYKVETDIIVADFSSGREIYLPIREALKDKDVGILVNNVGVFYPYPQYFTQLSEDKLWDIINVNIAAASLMVHVVLPGMVERKKGAIVTISSGSCCKPTPQLAAFSASKAYLDHFSRALQYEYASKGIFVQSLIPFYVATSMTAPSNFLHRCSWLVPSPKVYAHHAVSTLGISKRTTGYWSHSIQFLFAQYMPEWLWVWGANILNRSLRKEALSCTA
Tissue specificity：Highly expressed in testis and ovary. Also detected in thyroid, spinal cord, adrenal gland, heart, placenta, skeletal muscle, small intestine, colon, spleen, prostate and pancreas. {ECO:0000269|PubMed:12153137, ECO:0000269|PubMed:19026618}.
Induction：
Developmental stage：
Protein families：Short-chain dehydrogenases/reductases (SDR) family, 17-beta-HSD 3 subfamily