SH3BG_HUMAN   P55822


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P55822

Recommended name:SH3 domain-binding glutamic acid-rich protein

EC number:

Alternative names:(SH3BGR protein) (21-glutamic acid-rich protein) (21-GARP)

Cleaved into:

GeneID:6450

Gene names  (primary ):SH3BGR

Gene names  (synonym ):

Gene names  (ORF ):

Length:239

Mass:26086

Sequence:MPLLLLGETEPLKLERDCRSPVDPWAAASPDLALACLCHCQDLSSGAFPDRGVLGGVLFPTVEMVIKVFVATSSGSIAIRKKQQEVVGFLEANKIDFKELDIAGDEDNRRWMRENVPGEKKPQNGIPLPPQIFNEEQYCGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDVGNLPEAQEKNEEEGETATEETEEIAMEGAEGEAEEEEETAEGEEPGEDEDS

Tissue specificity:Expressed in heart and skeletal muscle.

Induction:

Developmental stage:

Protein families:SH3BGR family


   💬 WhatsApp