SH3L3_HUMAN   Q9H299


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9H299

Recommended name:SH3 domain-binding glutamic acid-rich-like protein 3

EC number:

Alternative names:(SH3 domain-binding protein 1) (SH3BP-1)

Cleaved into:

GeneID:83442

Gene names  (primary ):SH3BGRL3

Gene names  (synonym ):

Gene names  (ORF ):P1725

Length:93

Mass:10438

Sequence:MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRALAGNPKATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLKLA

Tissue specificity:Ubiquitous. {ECO:0000269|PubMed:11444877}.

Induction:

Developmental stage:

Protein families:SH3BGR family


   💬 WhatsApp