CSN7A_HUMAN Q9UBW8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UBW8
Recommended name：COP9 signalosome complex subunit 7a
EC number：
Alternative names：(SGN7a) (Signalosome subunit 7a) (Dermal papilla-derived protein 10) (JAB1-containing signalosome subunit 7a)
Cleaved into：
GeneID：50813
Gene names (primary )：COPS7A
Gene names (synonym )：CSN7A DERP10
Gene names (ORF )：
Length：275
Mass：30277
Sequence：MSAEVKVTGQNQEQFLLLAKSAKGAALATLIHQVLEAPGVYVFGELLDMPNVRELAESDFASTFRLLTVFAYGTYADYLAEARNLPPLTEAQKNKLRHLSVVTLAAKVKCIPYAVLLEALALRNVRQLEDLVIEAVYADVLRGSLDQRNQRLEVDYSIGRDIQRQDLSAIARTLQEWCVGCEVVLSGIEEQVSRANQHKEQQLGLKQQIESEVANLKKTIKVTTAAAAAATSQDPEQHLTELREPAPGTNQRQPSKKASKGKGLRGSAKIWSKSN
Tissue specificity：Widely expressed. Expressed at high level in brain, heart and skeletal muscle. {ECO:0000269|PubMed:12020345}.
Induction：
Developmental stage：
Protein families：CSN7/EIF3M family, CSN7 subfamily