S10A1_HUMAN P23297
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23297
Recommended name:Protein S100-A1
EC number:
Alternative names:(S-100 protein alpha chain) (S-100 protein subunit alpha) (S100 calcium-binding protein A1)
Cleaved into:
GeneID:6271
Gene names (primary ):S100A1
Gene names (synonym ):S100A
Gene names (ORF ):
Length:94
Mass:10546
Sequence:MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS
Tissue specificity:Highly prevalent in heart. Also found in lesser quantities in skeletal muscle and brain. {ECO:0000269|PubMed:1384693}.
Induction:
Developmental stage:
Protein families:S-100 family