S10AD_HUMAN Q99584
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99584
Recommended name：Protein S100-A13
EC number：
Alternative names：(S100 calcium-binding protein A13)
Cleaved into：
GeneID：6284
Gene names (primary )：S100A13
Gene names (synonym )：
Gene names (ORF )：
Length：98
Mass：11471
Sequence：MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Tissue specificity：Expressed in heart and skeletal muscle.
Induction：
Developmental stage：
Protein families：S-100 family