RP25L_HUMAN   Q8N5L8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N5L8

Recommended name:Ribonuclease P protein subunit p25-like protein

EC number:

Alternative names:(RNase P protein subunit-like p25) (Rpp25-like protein)

Cleaved into:

GeneID:138716

Gene names  (primary ):RPP25L

Gene names  (synonym ):C9orf23

Gene names  (ORF ):

Length:163

Mass:17631

Sequence:MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS

Tissue specificity:

Induction:

Developmental stage:

Protein families:Histone-like Alba family


   💬 WhatsApp