RNH2C_HUMAN   Q8TDP1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TDP1

Recommended name:Ribonuclease H2 subunit C

EC number:

Alternative names:(RNase H2 subunit C) (Aicardi-Goutieres syndrome 3 protein) (AGS3) (RNase H1 small subunit) (Ribonuclease HI subunit C)

Cleaved into:

GeneID:84153

Gene names  (primary ):RNASEH2C

Gene names  (synonym ):AYP1

Gene names  (ORF ):

Length:164

Mass:17840

Sequence:MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLEVSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFIGATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:16845400}.

Induction:

Developmental stage:

Protein families:RNase H2 subunit C family


   💬 WhatsApp