RPAB2_HUMAN P61218
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61218
Recommended name：DNA-directed RNA polymerases I, II, and III subunit RPABC2
EC number：
Alternative names：(RNA polymerases I, II, and III subunit ABC2) (DNA-directed RNA polymerase II subunit F) (DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide) (RPABC14.4) (RPB14.4) (RPB6 homolog) (RPC15)
Cleaved into：
GeneID：5435
Gene names (primary )：POLR2F
Gene names (synonym )：POLRF
Gene names (ORF )：
Length：127
Mass：14478
Sequence：MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGVDELIITD
Tissue specificity：
Induction：
Developmental stage：
Protein families：Archaeal RpoK/eukaryotic RPB6 RNA polymerase subunit family