RPAC2_HUMAN P0DPB6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0DPB6
Recommended name：DNA-directed RNA polymerases I and III subunit RPAC2
EC number：
Alternative names：(RNA polymerases I and III subunit AC2) (AC19) (DNA-directed RNA polymerase I subunit D) (RNA polymerase I 16 kDa subunit) (RPA16) (RPC16) (hRPA19)
Cleaved into：
GeneID：51082
Gene names (primary )：POLR1D
Gene names (synonym )：
Gene names (ORF )：
Length：133
Mass：15237
Sequence：MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF
Tissue specificity：
Induction：
Developmental stage：
Protein families：Archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family