RPB4_HUMAN O15514
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15514
Recommended name：DNA-directed RNA polymerase II subunit RPB4
EC number：
Alternative names：(RNA polymerase II subunit B4) (DNA-directed RNA polymerase II subunit D) (RNA polymerase II 16 kDa subunit) (RPB16)
Cleaved into：
GeneID：5433
Gene names (primary )：POLR2D
Gene names (synonym )：
Gene names (ORF )：
Length：142
Mass：16311
Sequence：MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY
Tissue specificity：
Induction：
Developmental stage：
Protein families：Eukaryotic RPB4 RNA polymerase subunit family