RPB11_HUMAN P52435
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52435
Recommended name：DNA-directed RNA polymerase II subunit RPB11-a
EC number：
Alternative names：(RNA polymerase II subunit B11-a) (RPB11a) (DNA-directed RNA polymerase II subunit J-1) (RNA polymerase II 13.3 kDa subunit)
Cleaved into：
GeneID：5439
Gene names (primary )：POLR2J
Gene names (synonym )：POLR2J1
Gene names (ORF )：
Length：117
Mass：13293
Sequence：MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Tissue specificity：Ubiquitously expressed. High expression was found in heart and skeletal muscle. {ECO:0000269|PubMed:11747469}.
Induction：
Developmental stage：
Protein families：Archaeal RpoL/eukaryotic RPB11/RPC19 RNA polymerase subunit family