RN3P1_HUMAN   Q2M238


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q2M238

Recommended name:Putative RRN3-like protein RRN3P1

EC number:

Alternative names:(RNA polymerase I transcription factor homolog pseudogene 1)

Cleaved into:

GeneID:

Gene names  (primary ):RRN3P1

Gene names  (synonym ):

Gene names  (ORF ):

Length:152

Mass:17255

Sequence:MGFAEAFLEHLWKNLQDPSNPAIIRQAAGNYIGSFLARAKFISLITVKPCLDLLVNWLHIYLNNQDSGTKAFCDVALHGPFYSACQAVFYTFVFRHKQLLSGNLKEGLQYPQSLNFERIVMSQLNPLKICLPSVVNFFAAITKMKTCGYGWW

Tissue specificity:

Induction:

Developmental stage:

Protein families:RRN3 family


   💬 WhatsApp