RL3R2_HUMAN Q8TDU9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8TDU9
Recommended name：Relaxin-3 receptor 2
EC number：
Alternative names：(RLN3 receptor 2) (G-protein coupled receptor 100) (G-protein coupled receptor GPCR142) (Insulin-like peptide INSL5 receptor) (Relaxin family peptide receptor 4)
Cleaved into：
GeneID：339403
Gene names (primary )：RXFP4
Gene names (synonym )：GPCR142 GPR100 RLN3R2
Gene names (ORF )：
Length：374
Mass：41141
Sequence：MPTLNTSASPPTFFWANASGGSVLSADDAPMPVKFLALRLMVALAYGLVGAIGLLGNLAVLWVLSNCARRAPGPPSDTFVFNLALADLGLALTLPFWAAESALDFHWPFGGALCKMVLTATVLNVYASIFLITALSVARYWVVAMAAGPGTHLSLFWARIATLAVWAAAALVTVPTAVFGVEGEVCGVRLCLLRFPSRYWLGAYQLQRVVLAFMVPLGVITTSYLLLLAFLQRRQRRRQDSRVVARSVRILVASFFLCWFPNHVVTLWGVLVKFDLVPWNSTFYTIQTYVFPVTTCLAHSNSCLNPVLYCLLRREPRQALAGTFRDLRLRLWPQGGGWVQQVALKQVGRRWVASNPRESRPSTLLTNLDRGTPG
Tissue specificity：Expressed in a broader range of tissues including brain, kidney, testis, thymus, placenta, prostate, salivary gland, thyroid and colon. {ECO:0000269|PubMed:14530218}.
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family