RL37L_HUMAN   A6NKH3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NKH3

Recommended name:Putative 60S ribosomal protein L37a-like protein

EC number:

Alternative names:(Ribosomal protein L37a pseudogene 8)

Cleaved into:

GeneID:

Gene names  (primary ):RPL37AP8

Gene names  (synonym ):RPL37L

Gene names  (ORF ):

Length:93

Mass:10583

Sequence:MAKCTKKVGGIVSKYRTHHGASLWKMVKEIEISQHTKYTCSFCGKTKMKRRAVKIRHCNSCMKTVAGSAWTYNTTSAVMVKSAIRRLKELKDQ

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic ribosomal protein eL43 family


   💬 WhatsApp