RLP24_HUMAN   Q9UHA3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UHA3

Recommended name:Probable ribosome biogenesis protein RLP24

EC number:

Alternative names:(Ribosomal L24 domain-containing protein 1) (Ribosomal protein L24-like)

Cleaved into:

GeneID:51187

Gene names  (primary ):RSL24D1

Gene names  (synonym ):C15orf15 RPL24L

Gene names  (ORF ):My024

Length:163

Mass:19621

Sequence:MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQEDVDMEDAP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Eukaryotic ribosomal protein eL24 family


   💬 WhatsApp