GDIR3_HUMAN   Q99819


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q99819

Recommended name:Rho GDP-dissociation inhibitor 3

EC number:

Alternative names:(Rho GDI 3) (Rho-GDI gamma)

Cleaved into:

GeneID:398

Gene names  (primary ):ARHGDIG

Gene names  (synonym ):

Gene names  (ORF ):

Length:225

Mass:25098

Sequence:MLGLDACELGAQLLELLRLALCARVLLADKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNVQVTRLTLLSEQAPGPVVMDLTGDLAVLKDQVFVLKEGVDYRVKISFKVHREIVSGLKCLHHTYRRGLRVDKTVYMVGSYGPSAQEYEFVTPVEEAPRGALVRGPYLVVSLFTDDDRTHHLSWEWGLCICQDWKD

Tissue specificity:Primarily expressed in pancreas and brain.

Induction:

Developmental stage:

Protein families:Rho GDI family


   💬 WhatsApp