GDIR2_HUMAN   P52566


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52566

Recommended name:Rho GDP-dissociation inhibitor 2

EC number:

Alternative names:(Rho GDI 2) (Ly-GDI) (Rho-GDI beta)

Cleaved into:

GeneID:397

Gene names  (primary ):ARHGDIB

Gene names  (synonym ):GDIA2 GDID4 RAP1GN1

Gene names  (ORF ):

Length:201

Mass:22988

Sequence:MTEKAPEPHVEEDDDDELDSKLNYKPPPQKSLKELQEMDKDDESLIKYKKTLLGDGPVVTDPKAPNVVVTRLTLVCESAPGPITMDLTGDLEALKKETIVLKEGSEYRVKIHFKVNRDIVSGLKYVQHTYRTGVKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDDDKQDHLSWEWNLSIKKEWTE

Tissue specificity:Detected in bone marrow, thymus and spleen. {ECO:0000269|PubMed:8356058}.

Induction:

Developmental stage:

Protein families:Rho GDI family


   💬 WhatsApp