RND1_HUMAN   Q92730


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q92730

Recommended name:Rho-related GTP-binding protein Rho6

EC number:

Alternative names:(Rho family GTPase 1) (Rnd1)

Cleaved into:

GeneID:27289

Gene names  (primary ):RND1

Gene names  (synonym ):RHO6

Gene names  (ORF ):

Length:232

Mass:26056

Sequence:MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM

Tissue specificity:Mostly expressed in brain and liver.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Rho family


   💬 WhatsApp