ULBP6_HUMAN Q5VY80
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5VY80
Recommended name：UL16-binding protein 6
EC number：
Alternative names：(Retinoic acid early transcript 1L protein)
Cleaved into：
GeneID：154064
Gene names (primary )：RAET1L
Gene names (synonym )：ULBP6
Gene names (ORF )：
Length：246
Mass：27509
Sequence：MAAAAIPALLLCLPLLFLLFGWSRARRDDPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTMAWKAQNPVLREVVDILTEQLLDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSIDGQTFLLFDSEKRMWTTVHPGARKMKEKWENDKDVAMSFHYISMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI
Tissue specificity：Widely expressed (PubMed:11827464). Expressed in trachea (PubMed:19658097). Constitutively expressed in peripheral blood mononuclear cells, including B-cells and natural killer cells, as well as CD4+ and CD8+ T-cells and monocytes. Tends to be up-regulated in various lymphoid malignancies, including chronic lymphocytic leukemia (PubMed:28559451). {ECO:0000269|PubMed:11827464, ECO:0000269|PubMed:19658097, ECO:0000269|PubMed:28559451}.
Induction：
Developmental stage：
Protein families：MHC class I family