RBAS1_HUMAN   Q9P1G2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P1G2

Recommended name:Putative uncharacterized protein encoded by RBM12B-AS1

EC number:

Alternative names:(RBM12B antisense RNA 1) (RBM12B antisense gene protein 1)

Cleaved into:

GeneID:

Gene names  (primary ):RBM12B-AS1

Gene names  (synonym ):C8orf39

Gene names  (ORF ):PRO1905

Length:102

Mass:11378

Sequence:MAQDFSQHPQTGIIRRHRFYSPKPLSTTPRGQSFLLSRQAKVATWDPMLSPDFQPKSAFKLTWTAQPPCLSVTPSQGQTFHPNSPEGELPPDLTENTCPSQA

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp